Coilin (COIL) (Center) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 156-186 amino acids from the Central region of human COIL |
Coilin (COIL) (Center) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 156-186 amino acids from the Central region of human COIL |
Rabbit Polyclonal Anti-Coil Antibody
Applications | WB |
Reactivities | Rat |
Immunogen | The immunogen for Anti-Coil Antibody is: synthetic peptide directed towards the C-terminal region of Rat Coil. Synthetic peptide located within the following region: PETQQVDIEVLSSLPALKEPGKFDLVYHNENGTEVVEYAVTQEKRITVFW |
Rabbit Polyclonal Anti-COIL Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-COIL Antibody: synthetic peptide directed towards the C terminal of human COIL. Synthetic peptide located within the following region: DYSLLPLLAAAPQVGEKIAFKLLELTSSYSPDVSDYKEGRILSHNPETQQ |
COIL rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human COIL |
COIL rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human COIL |
Coilin Rabbit polyclonal Antibody
Applications | IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 297-576 of human Coilin (NP_004636.1). |
Modifications | Unmodified |
Coilin Rabbit polyclonal Antibody
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A synthesized peptide derived from human Coilin |
Coilin Rabbit monoclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |