Rabbit Polyclonal Anti-DND1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DND1 antibody: synthetic peptide directed towards the C terminal of human DND1. Synthetic peptide located within the following region: HRFWYQVVIPGHPVPFSGLIWVVLTLDGRDGHEVAKDAVSVRLLQALSES |
Rabbit Polyclonal Anti-Dnd1 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Dnd1 antibody is: synthetic peptide directed towards the middle region of Rat Dnd1. Synthetic peptide located within the following region: KYGGPPPGWVGSPPPSGSEVFIGRLPQDVYEHQLIPLFQRVGRLYEFRLM |
DND1 (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 197-226 amino acids from the Central region of Human DND1 |
DND1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human DND1 |
DND1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human DND1. |
Germany
Japan
United Kingdom
China
