Rabbit polyclonal anti-EPN3 antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human EPN3. |
Rabbit polyclonal anti-EPN3 antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human EPN3. |
EPN3 (N-term) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide selected from the N-terminal region of human EPN3 |
Rabbit Polyclonal Anti-EPN3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-EPN3 Antibody is: synthetic peptide directed towards the C-terminal region of Human EPN3. Synthetic peptide located within the following region: ESTETKEGLEQALPSGKPSSPVELDLFGDPSPSSKQNGTKEPDALDLGIL |
EPN3 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human EPN3 |