Rabbit Polyclonal Anti-GABA(A) Theta Receptor (extracellular)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide DYRMHEKLWVPDC, corresponding to amino acid residues 131-143 of mouse GABA(A) ? Receptor. Extracellular, N-terminus. |
Rabbit Polyclonal Anti-GABRQ Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GABRQ antibody: synthetic peptide directed towards the N terminal of human GABRQ. Synthetic peptide located within the following region: KFHFEFSSAVPEVVLNLFNCKNCANEAVVQKILDRVLSRYDVRLRPNFGG |
GABRQ Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 350-600 of human GABRQ (NP_061028.3). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
