Antibodies

Jump to Filters
View as table Download
Glutathione Peroxidase 7 (GPX7) Rabbit Polyclonal Antibody
TA308073

USD 415.00

5 Days

Rabbit polyclonal antibody to Glutathione peroxidase 7 (glutathione peroxidase 7)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 187 of GPX7 (Uniprot ID#Q96SL4)
Glutathione Peroxidase 7 (GPX7) Goat Polyclonal Antibody
TA303126

USD 375.00

5 Days

Goat Polyclonal Antibody against GPX7

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence CNQFGQQEPDSNK, from the internal region of the protein sequence according to NP_056511.2.
Gpx7 Rabbit Polyclonal Antibody
TA334097

USD 375.00

5 Days

Rabbit Polyclonal Anti-Gpx7 Antibody

Applications WB
Reactivities Rat
Immunogen The immunogen for Anti-Gpx7 Antibody is: synthetic peptide directed towards the C-terminal region of Rat Gpx7. Synthetic peptide located within the following region: RTYSVSFPMFSKIAVTGTGAHPAFKYLTQTSGKEPTWNFWKYLVAPDGKV
Glutathione Peroxidase 7 (GPX7) Rabbit Polyclonal Antibody
TA376762

USD 220.00

3 Weeks

GPX7 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 20-187 of human GPX7 (NP_056511.2).
Modifications Unmodified