Antibodies

Jump to Filters
View as table Download
Kcnt1 Mouse Monoclonal Antibody [Clone ID: S3-26]
TA326566

USD 410.00

5 Days

Mouse Monoclonal Anti-Slo2.2 Antibody

Applications WB
Reactivities Human (weak), Mouse, Rat
Conjugation Unconjugated
Kcnt1 Rabbit Polyclonal Antibody
TA328977

USD 585.00

3 Weeks

Rabbit polyclonal Anti-KCa4.1 (Slack)

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)KQEEKQNRRGLAG, corresponding to amino acid residues 619-631 of rat Slack . Intracellular, C-terminal.
Kcnt1 Rabbit Polyclonal Antibody
TA338442

USD 375.00

5 Days

Rabbit Polyclonal Anti-Kcnt1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Kcnt1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: CDLLSDQSEDEVTPSDDEGLSVVEYVKGYPPNSPYIGSSPTLCHLLPVKA