Antibodies

Jump to Filters
View as table Download
Lysosomal acid lipase (LIPA) Rabbit Polyclonal Antibody
TA309730

USD 424.00

2 Weeks

Rabbit Polyclonal Lipase A Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A genomic peptide made to an internal region of the human Lysosomal acid lipase protein (within residues 150-300). [Swiss-Prot P38571]
Lysosomal acid lipase (LIPA) Rabbit Polyclonal Antibody
TA343110

USD 375.00

5 Days

Rabbit Polyclonal Anti-LIPA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LIPA antibody: synthetic peptide directed towards the N terminal of human LIPA. Synthetic peptide located within the following region: SYWGFPSEEYLVETEDGYILCLNRIPHGRKNHSDKGPKPVVFLQHGLLAD
Lysosomal acid lipase (LIPA) Rabbit Polyclonal Antibody
TA378063

USD 220.00

3 Weeks

LIPA Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 110-399 of human LIPA (NP_001121077.1).
Modifications Unmodified