MEF2D (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 115-144 amino acids from the N-terminal region of human MEF2D |
MEF2D (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 115-144 amino acids from the N-terminal region of human MEF2D |
Rabbit Polyclonal Anti-MEF2D Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MEF2D antibody: synthetic peptide directed towards the middle region of human MEF2D. Synthetic peptide located within the following region: GDGLSSPAGGSYETGDRDDGRGDFGPTLGLLRPAPEPEAEGSAVKRMRLD |
Carrier-free (BSA/glycerol-free) MEF2D mouse monoclonal antibody, clone OTI3D12 (formerly 3D12)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MEF2D mouse monoclonal antibody, clone OTI1E11 (formerly 1E11)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MEF2D mouse monoclonal antibody, clone OTI10B4 (formerly 10B4)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
MEF2D Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 431-521 of human MEF2D (NP_005911.1). |
Modifications | Unmodified |
MEF2D mouse monoclonal antibody, clone OTI3D12 (formerly 3D12)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
MEF2D mouse monoclonal antibody, clone OTI3D12 (formerly 3D12), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
MEF2D mouse monoclonal antibody, clone OTI3D12 (formerly 3D12), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
MEF2D mouse monoclonal antibody, clone OTI3D12 (formerly 3D12)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
MEF2D mouse monoclonal antibody, clone OTI1E11 (formerly 1E11)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
MEF2D mouse monoclonal antibody, clone OTI1E11 (formerly 1E11), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
MEF2D mouse monoclonal antibody, clone OTI1E11 (formerly 1E11), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
MEF2D mouse monoclonal antibody, clone OTI1E11 (formerly 1E11)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
MEF2D mouse monoclonal antibody, clone OTI10B4 (formerly 10B4)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
MEF2D mouse monoclonal antibody, clone OTI10B4 (formerly 10B4), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
MEF2D mouse monoclonal antibody, clone OTI10B4 (formerly 10B4), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
MEF2D mouse monoclonal antibody, clone OTI10B4 (formerly 10B4)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |