Antibodies

Jump to Filters
View as table Download
PLD6 (Center) Rabbit Polyclonal Antibody
AP53346PU-N

USD 450.00

2 Weeks

PLD6 (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 132-162 amino acids from the Central region of human PLD6
PLD6 Rabbit Polyclonal Antibody
TA334803

USD 375.00

5 Days

Rabbit Polyclonal Anti-PLD6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PLD6 antibody is: synthetic peptide directed towards the C-terminal region of Human PLD6. Synthetic peptide located within the following region: ITEDDEYVRLFLEEFERIWEQFNPTKYTFFPPKKSHGSCAPPVSRAGGRL