Antibodies

Jump to Filters
View as table Download
PRSS23 Rabbit Polyclonal Antibody
TA340155

USD 375.00

5 Days

Rabbit Polyclonal Anti-PRSS23 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PRSS23 antibody: synthetic peptide directed towards the C terminal of human PRSS23. Synthetic peptide located within the following region: VSPPAKQLPGGRIHFSGYDNDRPGNLVYRFCDVKDETYDLLYQQCDAQPG
PRSS23 Rabbit Polyclonal Antibody
TA380428

USD 220.00

3 Weeks

PRSS23 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 101-220 of human PRSS23 (NP_009104.2).