Antibodies

View as table Download

Rabbit Polyclonal Anti-RHOXF1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RHOXF1 antibody: synthetic peptide directed towards the N terminal of human RHOXF1. Synthetic peptide located within the following region: PEGGVNHENGMNRDGGMIPEGGGGNQEPRQQPQPPPEEPAQAAMEGPQPE

Rabbit Polyclonal Anti-RHOXF1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RHOXF1 antibody: synthetic peptide directed towards the C terminal of human RHOXF1. Synthetic peptide located within the following region: ELESVFRHTQYPDVPTRRELAENLGVTEDKVRVWFKNKRARCRRHQRELM

Rabbit Polyclonal Anti-RHOXF1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RHOXF1 Antibody: synthetic peptide directed towards the C terminal of human RHOXF1. Synthetic peptide located within the following region: VPTRRELAENLGVTEDKVRVWFKNKRARCRRHQRELMLANELRADPDDCV