Antibodies

Jump to Filters
View as table Download
RPL18 Rabbit Polyclonal Antibody
TA314462

USD 345.00

In Stock

Rabbit polyclonal anti-RPL18 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human RPL18.
RPL18 Rabbit Polyclonal Antibody
TA335159

USD 375.00

5 Days

Rabbit polyclonal Anti-RPL18 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RPL18 antibody: synthetic peptide directed towards the N terminal of human RPL18. Synthetic peptide located within the following region: MGVDIRHNKDRKVRRKEPKSQDIYLRLLVKLYRFLARRTNSTFNQVVLKR
RPL18 Rabbit Polyclonal Antibody
TA357281

USD 360.00

5 Days

RPL18 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human RPL18
RPL18 Rabbit Polyclonal Antibody
TA381040

USD 220.00

3 Weeks

RPL18 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-188 of human RPL18 (NP_000970.1).
Modifications Unmodified