Antibodies

View as table Download

Rabbit Polyclonal SCUBE3 Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen SCUBE3 antibody was raised against a 15 amino acid synthetic peptide near the center of human SCUBE3.

Rabbit Polyclonal Anti-SCUBE3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SCUBE3 antibody is: synthetic peptide directed towards the N-terminal region of Human SCUBE3. Synthetic peptide located within the following region: MNCMNKNHGCAHICRETPKGGIACECRPGFELTKNQRDCKLTCNYGNGGC