Antibodies

Jump to Filters
View as table Download
AE2 (SLC4A2) Rabbit Polyclonal Antibody
TA334051

USD 375.00

5 Days

Rabbit Polyclonal Anti-SLC4A2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-SLC4A2 Antibody: synthetic peptide directed towards the N terminal of human SLC4A2. Synthetic peptide located within the following region: MSSAPRRPAKGADSFCTPEPESLGPGTPGFPEQEEDELHRTLGVERFEEI
AE2 (SLC4A2) Rabbit Polyclonal Antibody
TA381673

USD 220.00

3 Weeks

SLC4A2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 200-300 of human SLC4A2 (NP_001186623.1).
Modifications Unmodified