Rabbit Polyclonal Anti-SLC7A2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SLC7A2 Antibody: synthetic peptide directed towards the middle region of human SLC7A2. Synthetic peptide located within the following region: VANWKISEEFLKNISASAREPPSENGTSIYGAGGFMPYGFTGTLAGAATC |
SLC7A2 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human SLC7A2 |
SLC7A2 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 500 to the C-terminus of human SLC7A2 (NP_001008539.3). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China