Antibodies

View as table Download

Rabbit polyclonal anti-SYT16 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human SYT16.

Rabbit Polyclonal Anti-SYT16 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SYT16 antibody: synthetic peptide directed towards the N terminal of human SYT16. Synthetic peptide located within the following region: DKLDQDLDNIQIQETYFEDEEQDNDWSQEDANSLFLEVDHFSCCNSDLQD