Rabbit Polyclonal Anti-ADH1A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ADH1A antibody: synthetic peptide directed towards the N terminal of human ADH1A. Synthetic peptide located within the following region: ESNYCLKNDVSNPQGTLQDGTSRFTCRRKPIHHFLGISTFSQYTVVDENA |
Rabbit Polyclonal Anti-ADH1A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ADH1A antibody: synthetic peptide directed towards the N terminal of human ADH1A. Synthetic peptide located within the following region: NYCLKNDVSNPQGTLQDGTSRFTCRRKPIHHFLGISTFSQYTVVDENAVA |
Goat Polyclonal Antibody against ADH1A, B, C
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence STAGKVMKCKA, from the N Terminus of the protein sequence according to NP_000658.1; NP_000659.2; NP_000660.1. |
ADH1A Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human ADH1A |
Alcohol Dehydrogenase Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 220-300 of human Alcohol Dehydrogenase (NP_000658.1). |
| Modifications | Unmodified |
ADH1A/ADH1B/ADH1C Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 280 to the C-terminus of human ADH1A/ADH1B/ADH1C (NP_000659.2). |
Germany
Japan
United Kingdom
China
