Rabbit Polyclonal Anti-Ap3b1 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Ap3b1 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: MSSNSFAYNEQSGGGEAAELGQEATSTISSSGAFGLFSSDWKKNEDLKQM |
AP3B1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human AP3B1 |
AP3B1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 895-1094 of human AP3B1 (NP_003655.3). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China