Antibodies

Jump to Filters
View as table Download
Aqp7 Rabbit Polyclonal Antibody
TA329019

USD 585.00

2 Weeks

Rabbit polyclonal Anti-Aquaporin 7

Applications IF, IHC, WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide corresponding to amino acid? residues 7-24 of rat AQP-7. Intracellular, N-terminus.
Aquaporin 7 (AQP7) Rabbit Polyclonal Antibody
TA331176

USD 375.00

5 Days

Rabbit Polyclonal Anti-AQP7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AQP7 antibody: synthetic peptide directed towards the C terminal of human AQP7. Synthetic peptide located within the following region: DSVAYEDHGITVLPKMGSHEPTISPLTPVSVSPANRSSVHPAPPLHESMA