Antibodies

Jump to Filters
View as table Download
BCL6B Rabbit Polyclonal Antibody
TA345618

USD 475.00

5 Days

Rabbit Polyclonal Anti-BCL6B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BCL6B antibody: synthetic peptide directed towards the middle region of human BCL6B. Synthetic peptide located within the following region: LQSDLDQPAFQQLVSFSESGSLGNSSGSDVTSLSSQLPDTPNSMVPSPVE
BCL6B Rabbit Polyclonal Antibody
TA369826

USD 380.00

4 Weeks

BCL6B rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human BCL6B