Antibodies

Jump to Filters
View as table Download
C4BPB Rabbit Polyclonal Antibody
TA334285

USD 375.00

5 Days

Rabbit Polyclonal Anti-C4BPB Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C4BPB antibody: synthetic peptide directed towards the N terminal of human C4BPB. Synthetic peptide located within the following region: CCLMVAWRVSASDAEHCPELPPVDNSIFVAKEVEGQILGTYVCIKGYHLV
C4BPB Rabbit Polyclonal Antibody
TA374157

USD 220.00

3 Weeks

C4BPB Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 18-251 of human C4BPB (NP_001017364.1).
Modifications Unmodified