Antibodies

View as table Download

CPNE7 mouse monoclonal antibody, clone CPNE7-01, Aff - Purified

Applications WB
Reactivities Human

Rabbit Polyclonal Anti-Cpne7 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Cpne7 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: GARIPPKYEVSHDFAINFNPEDDECEGIQGVVEAYQNCLPKVQLYGPTNV

Rabbit Polyclonal Anti-Cpne7 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Cpne7 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: GDDGILRSPRGEPALRDIVQFVPFRELKNASPAALAKCVLAEVPKQVVEY