Antibodies

Jump to Filters
View as table Download
Cullin 5 (CUL5) Rabbit Polyclonal Antibody
TA332647

USD 275.00

3 Weeks

Rabbit anti-CUL5 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human CUL5
Cullin 5 (CUL5) Rabbit Polyclonal Antibody
TA338536

USD 310.00

5 Days

Rabbit Polyclonal Anti-CUL5 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CUL5 antibody: synthetic peptide directed towards the C terminal of human CUL5. Synthetic peptide located within the following region: VNIKILNAGAWSRSSEKVFVSLPTELEDLIPEVEEFYKKNHSGRKLHWHH
Cullin 5 (CUL5) Rabbit Monoclonal Antibody [Clone ID: R02-5K8]
TA384065

USD 380.00

4 Weeks

Cullin 5 Rabbit monoclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated