Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-DDX39 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DDX39 antibody: synthetic peptide directed towards the N terminal of human DDX39. Synthetic peptide located within the following region: MAEQDVENDLLDYDEEEEPQAPQESTPAPPKKDIKGSYVSIHSSGFRDFL |
DDX39A rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human DDX39A |
DDX39A Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 178-427 of human DDX39A (NP_005795.2). |
| Modifications | Unmodified |
DDX39A Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 178-427 of human DDX39A (NP_005795.2). |
| Modifications | Unmodified |
Phospho-DDX39A-Y138 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic phosphorylated peptide around Y138 of human DDX39A. |
| Modifications | Phospho Y138 |
Active filters
Target Symbol
- DDX39A
Applications
- WB