Antibodies

View as table Download

Rabbit Polyclonal Anti-DHFRL1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DHFRL1 antibody: synthetic peptide directed towards the middle region of human DHFRL1. Synthetic peptide located within the following region: RINLVLSRELKEPPQGAHFLARSLDDALKLTERPELANKVDMIWIVGGSS

Carrier-free (BSA/glycerol-free) DHFRL1 mouse monoclonal antibody, clone OTI1E2 (formerly 1E2)

Applications IF, WB
Reactivities Human, Monkey, Mouse, Dog
Conjugation Unconjugated

DHFRL1 mouse monoclonal antibody, clone OTI1E2 (formerly 1E2)

Applications IF, WB
Reactivities Human, Monkey, Mouse, Dog
Conjugation Unconjugated

DHFRL1 mouse monoclonal antibody, clone OTI1E2 (formerly 1E2)

Applications IF, WB
Reactivities Human, Monkey, Mouse, Dog
Conjugation Unconjugated