Rabbit Polyclonal Anti-EGR3 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human EGR3 |
Rabbit Polyclonal Anti-EGR3 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human EGR3 |
Rabbit Polyclonal Anti-EGR3 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-EGR3 Antibody: synthetic peptide directed towards the middle region of human EGR3. Synthetic peptide located within the following region: HIRTHTGEKPFACEFCGRKFARSDERKRHAKIHLKQKEKKAEKGGAPSAS |
Rabbit Polyclonal Anti-EGR3 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-EGR3 Antibody: synthetic peptide directed towards the middle region of human EGR3. Synthetic peptide located within the following region: ALPPYSNCGDLYSEPVSFHDPQGNPGLAYSPQDYQSAKPALDSNLFPMIP |
EGR3 rabbit polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse |
Rabbit Polyclonal Anti-EGR3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-EGR3 antibody: synthetic peptide directed towards the N terminal of human EGR3. Synthetic peptide located within the following region: LFSGSSDSVVHYNQMATENVMDIGLTNEKPNPELSYSGSFQPAPGNKTVT |
Rabbit Polyclonal Anti-EGR3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-EGR3 antibody: synthetic peptide directed towards the middle region of human EGR3. Synthetic peptide located within the following region: FCGRKFARSDERKRHAKIHLKQKEKKAEKGGAPSASSAPPVSLAPVVTTC |
EGR3 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-250 of human EGR3 (NP_004421.2). |
Modifications | Unmodified |