Antibodies

View as table Download

Rabbit Polyclonal Anti-EGR3 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human EGR3

Rabbit Polyclonal Anti-EGR3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-EGR3 Antibody: synthetic peptide directed towards the middle region of human EGR3. Synthetic peptide located within the following region: HIRTHTGEKPFACEFCGRKFARSDERKRHAKIHLKQKEKKAEKGGAPSAS

Rabbit Polyclonal Anti-EGR3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-EGR3 Antibody: synthetic peptide directed towards the middle region of human EGR3. Synthetic peptide located within the following region: ALPPYSNCGDLYSEPVSFHDPQGNPGLAYSPQDYQSAKPALDSNLFPMIP

EGR3 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse

Rabbit Polyclonal Anti-EGR3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EGR3 antibody: synthetic peptide directed towards the N terminal of human EGR3. Synthetic peptide located within the following region: LFSGSSDSVVHYNQMATENVMDIGLTNEKPNPELSYSGSFQPAPGNKTVT

Rabbit Polyclonal Anti-EGR3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EGR3 antibody: synthetic peptide directed towards the middle region of human EGR3. Synthetic peptide located within the following region: FCGRKFARSDERKRHAKIHLKQKEKKAEKGGAPSASSAPPVSLAPVVTTC

EGR3 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-250 of human EGR3 (NP_004421.2).
Modifications Unmodified