Rabbit Polyclonal Anti-FGF17 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FGF17 antibody is: synthetic peptide directed towards the middle region of Human FGF17. Synthetic peptide located within the following region: KLIVETDTFGSRVRIKGAESEKYICMNKRGKLIGKPSGKSKDCVFTEIVL |
Rabbit Polyclonal Anti-FGF17 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human FGF17 |
FGF17 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human FGF17 |
FGF17 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 23-180 of human FGF17 (NP_003858.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China