Antibodies

Jump to Filters
View as table Download
Frizzled 5 (FZD5) Rabbit Polyclonal Antibody
TA311714

USD 345.00

In Stock

Rabbit polyclonal anti-FZD5 antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human FZD5.
Frizzled 5 (FZD5) Rabbit Polyclonal Antibody
TA344063

USD 475.00

5 Days

Rabbit Polyclonal Anti-FZD5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FZD5 antibody: synthetic peptide directed towards the C terminal of human FZD5. Synthetic peptide located within the following region: SRCCCRPRRGHKSGGAMAAGDYPEASAALTGRTGPPGPAATYHKQVSLSH
Frizzled 5 (FZD5) Rabbit Polyclonal Antibody
TA376410

USD 220.00

3 Weeks

FZD5 Rabbit polyclonal Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 130-240 of human FZD5 (NP_003459.2).
Modifications Unmodified