GANAB rabbit polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human GANAB |
GANAB rabbit polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human GANAB |
Rabbit Polyclonal antibody to alpha Glucosidase II (glucosidase, alpha; neutral AB)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 47 and 251 of alpha Glucosidase II |
Rabbit polyclonal antibody to alpha Glucosidase II (glucosidase, alpha; neutral AB)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 654 and 944 of alpha Glucosidase II (Uniprot ID#Q14697) |
Rabbit Polyclonal Anti-GANAB Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-GANAB Antibody: synthetic peptide directed towards the middle region of human GANAB. Synthetic peptide located within the following region: IIGAGKPAAVVLQTKGSPESRLSFQHDPETSVLVLRKPGINVASDWSIHL |
GANAB Rabbit polyclonal Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-260 of human GANAB (NP_001265123.1). |
Modifications | Unmodified |