Rabbit Polyclonal TIM-1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | TIM-1 antibody was raised against a 16 amino acid peptide from near the amino terminus of human TIM-1. |
Rabbit Polyclonal TIM-1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | TIM-1 antibody was raised against a 16 amino acid peptide from near the amino terminus of human TIM-1. |
Rabbit Polyclonal TIM-1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | TIM-1 antibody was raised against a 16 amino acid peptide from near the center of human TIM-1. |
Goat Polyclonal Anti-IL17C (aa160-172) Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-IL17C (aa160-172) Antibody: Peptide with sequence RRPCSRDGSGLPT, from the internal region of the protein sequence according to NP_037410.1. |
Rabbit Polyclonal TIM-1/KIM-1/HAVCR Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide (SPLYSYTTDGNDTVT) of human TIM-1 protein was used as immunogen for this antibody. This sequence corresponds to amino acids (aa) 248-262 of NP_036338 and aa 84-98 of EAW61615.1. Isoforms of TIM-1 have been described. For example, NP_036 |
Rabbit Polyclonal Anti-HAVCR1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HAVCR1 antibody: synthetic peptide directed towards the N terminal of human HAVCR1. Synthetic peptide located within the following region: CHYSGAVTSMCWNRGSCSLFTCQNGIVWTNGTHVTYRKDTRYKLLGDLSR |
Anti-HAVCR1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 72-89 amino acids of Human hepatitis A virus cellular receptor 1 |
Anti-HAVCR1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 72-89 amino acids of Human hepatitis A virus cellular receptor 1 |
HAVCR1 Antibody - middle region
Applications | WB |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse HAVCR1 |
HAVCR1 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 21-120 of human HAVCR1 (NP_036338.2). |
Modifications | Unmodified |
Hepatitis A Virus Cellular Receptor 1 Rabbit monoclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |