Antibodies

View as table Download

Rabbit Polyclonal Anti-HOXC8 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HOXC8 antibody: synthetic peptide directed towards the N terminal of human HOXC8. Synthetic peptide located within the following region: SHALVYGPGGSAPGFQHASHHVQDFFHHGTSGISNSGYQQNPCSLSCHGD

Rabbit Polyclonal Anti-HOXC8 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HOXC8 antibody: synthetic peptide directed towards the middle region of human HOXC8. Synthetic peptide located within the following region: SVVQYPDCKSSANTNSSEGQGHLNQNSSPSLMFPWMRPHAPGRRSGRQTY

Rabbit Polyclonal Anti-HOXC8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HOXC8 antibody: synthetic peptide directed towards the middle region of human HOXC8. Synthetic peptide located within the following region: QVKIWFQNRRMKWKKENNKDKLPGARDEEKVEEEGNEEEEKEEEEKEENK

Goat Anti-HOXC8 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence C-SLYGAQQEAS, from the internal region of the protein sequence according to NP_073149.1.

Anti-HOXC8 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 98-107 amino acids of Human homeobox C8

HOXC8 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human HOXC8 (NP_073149.1).
Modifications Unmodified