Rabbit Polyclonal IFRD1 Antibody
Applications | IHC, WB |
Reactivities | Human, Bovine, Canine, Porcine, Primate |
Conjugation | Unconjugated |
Immunogen | A portion of amino acids 70-120 of human Tis7 was used as the immunogen. |
Rabbit Polyclonal IFRD1 Antibody
Applications | IHC, WB |
Reactivities | Human, Bovine, Canine, Porcine, Primate |
Conjugation | Unconjugated |
Immunogen | A portion of amino acids 70-120 of human Tis7 was used as the immunogen. |
Rabbit Polyclonal Anti-IFRD1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-IFRD1 antibody: synthetic peptide directed towards the N terminal of human IFRD1. Synthetic peptide located within the following region: VQPFSDEDASIETMSHCSGYSDPSSFAEDGPEVLDEEGTQEDLEYKLKGL |
Rabbit Polyclonal Anti-IFRD1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-IFRD1 antibody: synthetic peptide directed towards the middle region of human IFRD1. Synthetic peptide located within the following region: LALLFELARGIESDFFYEDMESLTQMLRALATDGNKHRAKVDKRKQRSVF |
IFRD1 Rabbit polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-240 of human IFRD1 (NP_001541.2). |
Modifications | Unmodified |
IFRD1 Rabbit polyclonal Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-240 of human IFRD1 (NP_001541.2). |
Modifications | Unmodified |