Antibodies

Jump to Filters
View as table Download
Kallikrein 10 (KLK10) Rabbit Polyclonal Antibody
TA342159

USD 375.00

5 Days

Rabbit polyclonal Anti-KLK10 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KLK10 antibody: synthetic peptide directed towards the N terminal of human KLK10. Synthetic peptide located within the following region: LLPQNDTRLDPEAYGSPCARGSQPWQVSLFNGLSFHCAGVLVDQSWVLTA
Kallikrein 10 (KLK10) Rabbit Polyclonal Antibody
TA377858

USD 220.00

3 Weeks

KLK10 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 35-276 of human KLK10 (NP_001070968.1).
Modifications Unmodified