Antibodies

View as table Download

Rabbit polyclonal antibody to MAGEA11 (melanoma antigen family A, 11)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 78 and 173 of MAGEA11 (Uniprot ID#P43364)

Rabbit Polyclonal Anti-MAGEA11 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MAGEA11 antibody: synthetic peptide directed towards the middle region of human MAGEA11. Synthetic peptide located within the following region: FSSTLNVGTLEELPAAESPSPPQSPQEESFSPTAMDAIFGSLSDEGSGSQ

Rabbit Polyclonal Anti-MAGEA11 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human MAGEA11

MAGEA11 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human MAGEA11

MAGEA11 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human MAGEA11

MAGEA11 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human MAGEA11 (NP_005357.2).
Modifications Unmodified