Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-NLRC4 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NLRC4 antibody: synthetic peptide directed towards the C terminal of human NLRC4. Synthetic peptide located within the following region: QLNLAGNRVSSDGWLAFMGVFENLKQLVFFDFSTKEFLPDPALVRKLSQV |
Rabbit Polyclonal CARD12 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | N terminus (MNFIKDNSRALIQRMGM) of the A and B isoforms of the human CLAN protein. |
NLRC4 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 89-159 of mouse NLRC4 (NP_001028539.1). |
| Modifications | Unmodified |
NLRC4 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-250 of human NLRC4 (NP_067032.3). |
| Modifications | Unmodified |
Anti-NLRC4 (Ser-533), Phosphospecific Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- NLRC4
Applications
- WB