Rabbit Polyclonal Ipaf Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Ipaf antibody was raised against a synthetic peptide corresponding to amino acids near the C-terminus of human Ipaf. |
Rabbit Polyclonal Ipaf Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Ipaf antibody was raised against a synthetic peptide corresponding to amino acids near the C-terminus of human Ipaf. |
Rabbit Polyclonal Anti-NLRC4 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NLRC4 antibody: synthetic peptide directed towards the C terminal of human NLRC4. Synthetic peptide located within the following region: QLNLAGNRVSSDGWLAFMGVFENLKQLVFFDFSTKEFLPDPALVRKLSQV |
Rabbit Polyclonal CARD12 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | N terminus (MNFIKDNSRALIQRMGM) of the A and B isoforms of the human CLAN protein. |
NLRC4 Rabbit polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 89-159 of mouse NLRC4 (NP_001028539.1). |
Modifications | Unmodified |
NLRC4 Rabbit polyclonal Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-250 of human NLRC4 (NP_067032.3). |
Modifications | Unmodified |
Anti-NLRC4 (Ser-533), Phosphospecific Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |