Rabbit Polyclonal Anti-NOVA2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NOVA2 antibody: synthetic peptide directed towards the N terminal of human NOVA2. Synthetic peptide located within the following region: MEPEAPDSRKRPLETPPEVVCTKRSNTGEEGEYFLKVLIPSYAAGSIIGK |
Rabbit Polyclonal Anti-NOVA2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NOVA2 antibody: synthetic peptide directed towards the middle region of human NOVA2. Synthetic peptide located within the following region: EPEQVHKAVSAIVQKVQEDPQSSSCLNISYANVAGPVANSNPTGSPYASP |
NOVA2 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human NOVA2 |
Germany
Japan
United Kingdom
China
