Antibodies

Jump to Filters
View as table Download
OR1L4 Rabbit Polyclonal Antibody
TA337482

USD 375.00

5 Days

Rabbit Polyclonal Anti-OR1L4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR1L4 antibody is: synthetic peptide directed towards the C-terminal region of Human OR1L4. Synthetic peptide located within the following region: VYFRPLSMYSVMKGRVATVMYTVVTPMLNPFIYSLRNKDMKRGLKKLRHR