OR51S1 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 212-241 amino acids from the C-terminal region of human Olfactory receptor 51S1 |
OR51S1 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 212-241 amino acids from the C-terminal region of human Olfactory receptor 51S1 |
Rabbit Polyclonal Anti-OR51S1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-OR51S1 Antibody is: synthetic peptide directed towards the C-terminal region of Human OR51S1. Synthetic peptide located within the following region: LDPLLIFFSYGLIGKVLQGVESREDRWKAGQTCAAHLSAVLLFYIPMILL |