Rabbit Polyclonal Anti-PDCL2 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | PDCL2 antibody was raised against an 18 amino acid peptide near the carboxy terminus of human PDCL2. |
Rabbit Polyclonal Anti-PDCL2 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | PDCL2 antibody was raised against an 18 amino acid peptide near the carboxy terminus of human PDCL2. |
Rabbit Polyclonal Anti-Pdcl2 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Pdcl2 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Pdcl2. Synthetic peptide located within the following region: EKRLQEWKALKKKQKFGELREISGNQYVNEVTNAEKDLWVVIHLYRSSVP |