Antibodies

Jump to Filters
View as table Download
PDCL2 Rabbit Polyclonal Antibody
TA349068

USD 484.00

5 Days

Rabbit Polyclonal Anti-PDCL2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen PDCL2 antibody was raised against an 18 amino acid peptide near the carboxy terminus of human PDCL2.
Pdcl2 Rabbit Polyclonal Antibody
TA338838

USD 375.00

5 Days

Rabbit Polyclonal Anti-Pdcl2 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Pdcl2 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Pdcl2. Synthetic peptide located within the following region: EKRLQEWKALKKKQKFGELREISGNQYVNEVTNAEKDLWVVIHLYRSSVP