Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 17 of 17 results

(reset)

PEPD Rabbit Polyclonal Antibody

TA332680

USD 275.00

3 Weeks

Rabbit anti-PEPD Polyclonal Antibody

Applications	WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Recombinant protein of human PEPD

PEPD Rabbit Polyclonal Antibody

TA335138

USD 375.00

5 Days

Rabbit polyclonal Anti-PEPD Antibody

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-PEPD antibody: synthetic peptide directed towards the middle region of human PEPD. Synthetic peptide located within the following region: LGAVFMPHGLGHFLGIDVHDVGGYPEGVERIDEPGLRSLRTARHLQPGMV

PEPD Mouse Monoclonal Antibody [Clone ID: OTI5D5]

CF501655

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) PEPD mouse monoclonal antibody, clone OTI5D5 (formerly 5D5)

Applications	FC, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

PEPD Mouse Monoclonal Antibody [Clone ID: OTI1B7]

CF501727

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) PEPD mouse monoclonal antibody, clone OTI1B7 (formerly 1B7)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

Pepd Rabbit Polyclonal Antibody

TA357277

USD 360.00

5 Days

Pepd Antibody - middle region

Applications	WB
Reactivities	Mouse
Conjugation	Unconjugated

PEPD Rabbit Polyclonal Antibody

TA359703

USD 360.00

5 Days

PEPD Antibody - middle region

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen is a synthetic peptide directed towards the middle region of human PEPD

Pepd Rabbit Polyclonal Antibody

TA363173

USD 360.00

5 Days

PEPD Antibody - middle region

Applications	WB
Conjugation	Unconjugated
Immunogen	The immunogen is a synthetic peptide directed towards the middle region of mouse PEPD

PEPD Rabbit Polyclonal Antibody

TA366299

USD 380.00

4 Weeks

PEPD rabbit polyclonal antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein of human PEPD

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

PEPD Rabbit Polyclonal Antibody

TA370649

USD 380.00

4 Weeks

PEPD rabbit polyclonal antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein of human PEPD

PEPD Mouse Monoclonal Antibody [Clone ID: OTI5D5]

TA501655

USD 379.00

In Stock

PEPD mouse monoclonal antibody, clone OTI5D5 (formerly 5D5)

Applications	FC, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

PEPD Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5D5]

TA501655AM

USD 420.00

4 Weeks

PEPD mouse monoclonal antibody, clone OTI5D5 (formerly 5D5), Biotinylated

Applications	FC, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

PEPD Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5D5]

TA501655BM

USD 420.00

4 Weeks

PEPD mouse monoclonal antibody, clone OTI5D5 (formerly 5D5), HRP conjugated

Applications	FC, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

PEPD Mouse Monoclonal Antibody [Clone ID: OTI5D5]

TA501655S

USD 159.00

2 Days

PEPD mouse monoclonal antibody, clone OTI5D5 (formerly 5D5)

Applications	FC, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

PEPD Mouse Monoclonal Antibody [Clone ID: OTI1B7]

TA501727

USD 379.00

In Stock

Anti-PEPD mouse monoclonal antibody, clone OTI1B7 (formerly 1B7)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

PEPD Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1B7]

TA501727AM

USD 420.00

4 Weeks

Anti-PEPD mouse monoclonal antibody, clone OTI1B7 (formerly 1B7), Biotinylated

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

PEPD Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1B7]

TA501727BM

USD 420.00

4 Weeks

Anti-PEPD mouse monoclonal antibody, clone OTI1B7 (formerly 1B7), HRP conjugated

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

PEPD Mouse Monoclonal Antibody [Clone ID: OTI1B7]

TA501727S

USD 159.00

2 Days

Anti-PEPD mouse monoclonal antibody, clone OTI1B7 (formerly 1B7)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

1 - 17 of 17 results