PLD6 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 132-162 amino acids from the Central region of human PLD6 |
PLD6 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 132-162 amino acids from the Central region of human PLD6 |
Rabbit Polyclonal Anti-PLD6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PLD6 antibody is: synthetic peptide directed towards the C-terminal region of Human PLD6. Synthetic peptide located within the following region: ITEDDEYVRLFLEEFERIWEQFNPTKYTFFPPKKSHGSCAPPVSRAGGRL |