Germany
Japan
United Kingdom
China
Rabbit polyclonal DNA Polymerase lambda antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human DNA Polymerase ?. |
Antibodies
View as table Download
DNA Polymerase lambda (POLL) (C-term) rabbit polyclonal antibody, Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 546~575 amino acids from the C-terminal region of human DNA polymerase lambda. |
Rabbit Polyclonal Anti-POLL Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-POLL antibody is: synthetic peptide directed towards the middle region of Human POLL. Synthetic peptide located within the following region: DVDVLITHPDGRSHRGIFSRLLDSLRQEGFLTDDLVSQEENGQQQKYLGV |
Rabbit Polyclonal Anti-POLL Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-POLL antibody: synthetic peptide directed towards the middle region of human POLL. Synthetic peptide located within the following region: SLSEHALSTAVVRNTHGCKVGPGRVLPTPTEKDVFRLLGLPYREPAERDW |
POLL Antibody - middle region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse POLL |
POLL Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 421-575 of human POLL (NP_037406.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- POLL
Applications
- WB