Antibodies

Jump to Filters
View as table Download
Prostaglandin D2 Receptor (PTGDR) Rabbit Polyclonal Antibody
TA314400

USD 345.00

4 Weeks

Rabbit polyclonal anti-PTGDR antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PTGDR.
Prostaglandin D2 Receptor (PTGDR) Rabbit Polyclonal Antibody
TA343146

USD 375.00

5 Days

Rabbit Polyclonal Anti-PTGDR Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PTGDR antibody: synthetic peptide directed towards the C terminal of human PTGDR. Synthetic peptide located within the following region: FKDVKEKNRTSEEAEDLRALRFLSVISIVDPWIFIIFRSPVFRIFFHKIF
Prostaglandin D2 Receptor (PTGDR) Rabbit Polyclonal Antibody
TA357833

USD 360.00

5 Days

PTGDR Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Prostaglandin D2 Receptor (PTGDR) Rabbit Polyclonal Antibody
TA380495

USD 220.00

3 Weeks

PTGDR Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 220-359 of human PTGDR (NP_000944.1).
Modifications Unmodified