Rabbit polyclonal anti-PTGDR antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PTGDR. |
Rabbit polyclonal anti-PTGDR antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PTGDR. |
Rabbit Polyclonal Anti-PTGDR Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PTGDR antibody: synthetic peptide directed towards the C terminal of human PTGDR. Synthetic peptide located within the following region: FKDVKEKNRTSEEAEDLRALRFLSVISIVDPWIFIIFRSPVFRIFFHKIF |
PTGDR Antibody - C-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
PTGDR Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 220-359 of human PTGDR (NP_000944.1). |
Modifications | Unmodified |