Antibodies

View as table Download

Rabbit Polyclonal Anti-RAB4A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RAB4A antibody is: synthetic peptide directed towards the C-terminal region of Human RAB4A. Synthetic peptide located within the following region: VQCARKILNKIESGELDPERMGSGIQYGDAALRQLRSPRRAQAPNAQECG

USD 300.00

In Stock

Goat Polyclonal Anti-Rab4 Antibody

Applications WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 105 aa to the C-terminus of Rab4a produced in E. coli.

Mouse Monoclonal RAB4A Antibody

Applications WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated

RAB4A Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-218 of human RAB4A (NP_004569.2).
Modifications Unmodified