Antibodies

Jump to Filters
View as table Download
RSAD1 Rabbit Polyclonal Antibody
TA315580

USD 345.00

In Stock

Rabbit polyclonal anti-RSAD1 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human RSAD1.
RSAD1 Rabbit Polyclonal Antibody
TA344874

USD 475.00

5 Days

Rabbit Polyclonal Anti-RSAD1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RSAD1 antibody: synthetic peptide directed towards the middle region of human RSAD1. Synthetic peptide located within the following region: NWTYWQCGQYLGVGPGAHGRFMPQGAGGHTREARIQTLEPDNWMKEVMLF