C2orf18 (SLC35F6) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 336-366 amino acids from the C-terminal region of human CB018 |
C2orf18 (SLC35F6) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 336-366 amino acids from the C-terminal region of human CB018 |
Rabbit Polyclonal Anti-C2orf18 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-C2orf18 antibody: synthetic peptide directed towards the middle region of human C2orf18. Synthetic peptide located within the following region: GLFGFVILSLLLVPMYYIPAGSFSGNPRGTLEDALDAFCQVGQQPLIAVA |
SLC35F6 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human C2ORF18 |