Antibodies

View as table Download

Rabbit Polyclonal Anti-SLC24A6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SLC24A6 Antibody: synthetic peptide directed towards the middle region of human SLC24A6. Synthetic peptide located within the following region: SIGDAFSDFTLARQGYPRMAFSACFGGIIFNILVGVGLGCLLQISRSHTE

Rabbit Polyclonal Anti-SLC24A6 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human SLC8B1