Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-SMARCA1 Antibody
| Applications | Assay, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SMARCA1 Antibody: synthetic peptide directed towards the N terminal of human SMARCA1. Synthetic peptide located within the following region: EQDTAAVAATVAAADATATIVVIEDEQPGPSTSQEEGAAAAATEATAATE |
Rabbit Polyclonal Anti-SMARCA1 Antibody
| Applications | Assay, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SMARCA1 antibody: synthetic peptide directed towards the N terminal of mouse SMARCA1. Synthetic peptide located within the following region: VAVSDARATVVVVEDEQPGPSTFKEEGAAAAATEGTTATEKGEKKEKITS |
Rabbit Polyclonal Anti-SMARCA1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SMARCA1 Antibody: synthetic peptide directed towards the N terminal of human SMARCA1. Synthetic peptide located within the following region: QEEGAAAAATEATAATEKGEKKKEKNVSSFQLKLAAKAPKSEKEMDPEYE |
Rabbit Polyclonal Anti-SMARCA1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide directed towards the N terminal of human SMARCA1. Synthetic peptide located within the following region: EQDTAAVAATVAAADATATIVVIEDEQPGPSTSQEEGAAAAATEATAATE |
SMARCA1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human SMCA1 |
SMARCA1 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human SMARCA1 (NP_003060.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- SMARCA1
Applications
- WB