Antibodies

View as table Download

Rabbit Polyclonal Anti-SOX12 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SOX12 Antibody: synthetic peptide directed towards the C terminal of human SOX12. Synthetic peptide located within the following region: DCSALDRDPDLQPPSGTSHFEFPDYCTPEVTEMIAGDWRPSSIADLVFTY

Rabbit Polyclonal Anti-SOX12 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SOX12 Antibody: synthetic peptide directed towards the C terminal of human SOX12. Synthetic peptide located within the following region: DCSALDRDPDLQPPSGTSHFEFPDYCTPEVTEMIAGDWRPSSIADLVFTY