Antibodies

Jump to Filters
View as table Download
SUNC1 (SUN3) Rabbit Polyclonal Antibody
TA334963

USD 375.00

5 Days

Rabbit Polyclonal Anti-SUN3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SUN3 antibody: synthetic peptide directed towards the C terminal of human SUN3. Synthetic peptide located within the following region: IKLATKIIPTAVTMEHISEKVSPSGNISSAPKEFSVYGITKKCEGEEIFL
SUNC1 (SUN3) Rabbit Polyclonal Antibody
TA357168

USD 360.00

5 Days

SUN3 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human SUN3